RACK1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Gnb2l1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Gnb2l1. Synthetic peptide located within the following region: HIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIIN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	35 kDa
Gene Name	receptor for activated C kinase 1
Database Link	NP_006089 Entrez Gene 14694 Mouse UniProt ID P63244
Background	Gnb2l1 is involved in the recruitment, assembly and/or regulation of a variety of signaling molecules. Gnb2l1 interacts with a wide variety of proteins and plays a role in many cellular processes.
Synonyms	Gnb2-rs1; GNB2L1; H12.3; HLC-7; PIG21
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.