Vitamin D Binding protein (GC) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GC antibody: synthetic peptide directed towards the N terminal of human GC. Synthetic peptide located within the following region: KHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	51 kDa
Gene Name	GC, vitamin D binding protein
Database Link	NP_000574 Entrez Gene 2638 Human UniProt ID P02774
Background	The protein encoded by this gene belongs to the albumin gene family. It is a multifunctional protein found in plasma, ascitic fluid, cerebrospinal fluid and on the surface of many cell types. It binds to vitamin D and its plasma metabolites and transports them to target tissues. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Synonyms	DBP; GC; Gc-MAF; GcMAF; GRD3; HEL-S-51; VDBG; VDBP
Note	Immunogen Sequence Homology: Human: 100%; Pig: 86%; Rat: 79%; Horse: 79%
Reference Data
Protein Families	Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.