AKR1D1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-AKR1D1 antibody: synthetic peptide directed towards the middle region of human AKR1D1. Synthetic peptide located within the following region: YVDLYIIEVPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	aldo-keto reductase family 1, member D1
Database Link	NP_005980 Entrez Gene 6718 Human UniProt ID P51857
Background	The enzyme encoded by this gene is responsible for the catalysis of the 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. Deficiency of this enzyme may contribute to hepatic dysfunction. Three transcript variants encoding different isoforms have been found for this gene. Other variants may be present, but their full-length natures have not been determined yet.
Synonyms	3o5bred; CBAS2; SRD5B1
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Dog: 93%; Horse: 93%; Mouse: 92%; Pig: 86%; Bovine: 86%; Rat
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Androgen and estrogen metabolism, C21-Steroid hormone metabolism, Metabolic pathways, Primary bile acid biosynthesis

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.