ACSBG1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ACSBG1 antibody is: synthetic peptide directed towards the N-terminal region of Human ACSBG1. Synthetic peptide located within the following region: DPSMLDSRETPQESRQDMIVRTTQEKLKTSSLTDRQPLSKESLNHALELS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	79 kDa
Gene Name	acyl-CoA synthetase bubblegum family member 1
Database Link	NP_055977 Entrez Gene 23205 Human UniProt ID Q96GR2
Background	The protein encoded by this gene possesses long-chain acyl-CoA synthetase activity. It is thought to play a central role in brain very long-chain fatty acids metabolism and myelinogenesis.
Synonyms	BG; BG1; BGM; GR-LACS; LPD
Note	Immunogen Sequence Homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.