IMMP2L Rabbit Polyclonal Antibody
CAT#: TA342985
Rabbit Polyclonal Anti-IMMP2L Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-IMMP2L antibody: synthetic peptide directed towards the N terminal of human IMMP2L. Synthetic peptide located within the following region: LNPGGSQSSDVVLLNHWKVRNFEVHRGDIVSLVSPKNPEQKIIKRVIALE |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 20 kDa |
Gene Name | inner mitochondrial membrane peptidase subunit 2 |
Database Link | |
Background | The mitochondrial inner membrane peptidase (IMP) complex generates mature, active proteins in the mitochondrial intermembrane space by proteolytically removing the mitochondrial targeting presequence of nuclear-encoded proteins. IMP1 (IMMP1L; MIM 612323) and IMP2 are the catalytic subunits of the IMP complex. |
Synonyms | IMMP2L-IT1; IMP2; IMP2-LIKE |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 93% |
Reference Data | |
Protein Families | Druggable Genome, Protease |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |