UTP23 Rabbit Polyclonal Antibody
CAT#: TA342974
Rabbit Polyclonal Anti-UTP23 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-UTP23 antibody is: synthetic peptide directed towards the middle region of Human UTP23. Synthetic peptide located within the following region: SPKTIAFVKAVESGQLVSVHEKESIKHLKEEQGLVKNTEQSRRKKRKKIS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 28 kDa |
Gene Name | UTP23, small subunit processome component |
Database Link | |
Background | UTP23 may be involved in rRNA-processing and ribosome biogenesis. |
Synonyms | C8orf53 |
Note | Immunogen Sequence Homology: Human: 100%; Rabbit: 86%; Rat: 85%; Dog: 79%; Horse: 79%; Bovine: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |