UTP23 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-UTP23 antibody is: synthetic peptide directed towards the middle region of Human UTP23. Synthetic peptide located within the following region: SPKTIAFVKAVESGQLVSVHEKESIKHLKEEQGLVKNTEQSRRKKRKKIS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	28 kDa
Gene Name	UTP23, small subunit processome component
Database Link	NP_115710 Entrez Gene 84294 Human UniProt ID Q9BRU9
Background	UTP23 may be involved in rRNA-processing and ribosome biogenesis.
Synonyms	C8orf53
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 86%; Rat: 85%; Dog: 79%; Horse: 79%; Bovine: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.