MAP3K12 binding inhibitory protein 1 (MBIP) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MBIP antibody is: synthetic peptide directed towards the C-terminal region of Human MBIP. Synthetic peptide located within the following region: FQSVSFSGKRRKVQPPQQNYSLAELDEKISALKQALLRKSREAESMATHH
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	MAP3K12 binding inhibitory protein 1
Database Link	NP_057670 Entrez Gene 51562 Human UniProt ID Q9NS73
Background	MBIP inhibits the MAP3K12 activity to induce the activation of the JNK/SAPK pathway. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4.
Synonyms	MAP3K12 binding inhibitory protein 1; MUK-binding inhibitory protein; OTTHUMP00000178844
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Guinea pig: 100%; Bovine: 93%; Rat: 86%; Mouse: 86%; Rabbit: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.