OSGIN2 Rabbit Polyclonal Antibody
CAT#: TA342836
Rabbit Polyclonal Anti-OSGIN2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-OSGIN2 antibody: synthetic peptide directed towards the C terminal of human OSGIN2. Synthetic peptide located within the following region: ECIKEANLFALGPLVGDNFVRFLKGGALGVTRCLATRQKKKHLFVERGGG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 56 kDa |
Gene Name | oxidative stress induced growth inhibitor family member 2 |
Database Link | |
Background | OSGIN2 may be involved in meiosis or the maturation of germ cells. |
Synonyms | C8orf1; hT41 |
Note | Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Mouse: 87%; Bovine: 87%; Guinea pig: 80% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |