COL8A2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-COL8A2 antibody: synthetic peptide directed towards the middle region of human COL8A2. Synthetic peptide located within the following region: AAGLPGPQGPSGAKGEPGTRGPPGLIGPTGYGMPGLPGPKGDRGPAGVPG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	67 kDa
Gene Name	collagen type VIII alpha 2
Database Link	NP_005193 Entrez Gene 1296 Human UniProt ID P25067
Background	COL8A2 is the alpha 2 chain of type VIII collagen. The protein is a major component of the basement membrane of the corneal endothelium and forms homo- or heterotrimers with alpha 1 (VIII) type collagens. Defects in this COL8A2 gene are associated with Fuchs endothelial corneal dystrophy and posterior polymorphous corneal dystrophy type 2
Synonyms	FECD; FECD1; PPCD; PPCD2
Note	Immunogen Sequence Homology: Human: 100%; Zebrafish: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 92%; Rat: 92%; Mouse: 92%; Goat: 85%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.