PACAP receptor (ADCYAP1R1) Rabbit Polyclonal Antibody

Specifications

Product Data
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ADCYAP1R1 antibody: synthetic peptide directed towards the C terminal of human ADCYAP1R1. Synthetic peptide located within the following region: NESSIYLRLARSTLLLIPLFGIHYTVFAFSPENVSKRERLVFELGLGSFQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	51 kDa
Gene Name	ADCYAP receptor type I
Database Link	NP_001109 Entrez Gene 117 Human UniProt ID P41586
Background	This gene encodes type I adenylate cyclase activating polypeptide receptor, which is a membrane-associated protein and shares significant homology with members of the glucagon/secretin receptor family. This receptor mediates diverse biological actions of adenylate cyclase activating polypeptide 1 and is positively coupled to adenylate cyclase. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified.
Synonyms	PAC1; PAC1R; PACAPR; PACAPRI
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%
Reference Data
Protein Families	Druggable Genome, GPCR, Transmembrane
Protein Pathways	Neuroactive ligand-receptor interaction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.