CDKL5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CDKL5 antibody: synthetic peptide directed towards the C terminal of human CDKL5. Synthetic peptide located within the following region: SQASGGSSNIRQEPAPKGRPALQLPDGGCDGRRQRHHSGPQDRRFMLRTT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	115 kDa
Gene Name	cyclin dependent kinase like 5
Database Link	NP_003150 Entrez Gene 6792 Human UniProt ID O76039
Background	CDKL5 is a member of Ser/Thr protein kinase family. This protein is a phosphorylated protein with protein kinase activity. Mutations in this CDKL5 gene have been associated with X-linked infantile spasm syndrome (ISSX), also known as X-linked West syndrome, and Rett syndrome (RTT).
Synonyms	EIEE2; ISSX; STK9
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Druggable Genome, Protein Kinase

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.