MRGX1 (MRGPRX1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MRGPRX1 antibody is: synthetic peptide directed towards the C-terminal region of Human MRGPRX1. Synthetic peptide located within the following region: FLSALNSSANPIIYFFVGSFRQRQNRQNLKLVLQRALQDASEVDEGGGQL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	36 kDa
Gene Name	MAS related GPR family member X1
Database Link	NP_671732 Entrez Gene 259249 Human UniProt ID Q96LB2
Background	MRGPRX1 is an orphan receptor. MRGPRX1 is probably involved in the function of nociceptive neurons. It may regulate nociceptor function and/or development, including the sensation or modulation of pain. MRGPRX1 is potently activated by enkephalins including BAM22 (bovine adrenal medulla peptide 22) and BAM (8-22). BAM22 is the most potent compound and evoked a large and dose-dependent release of intracellular calcium in stably transfected cells. G(alpha)q proteins are involved in the calcium-signaling pathway. MRGPRX1 is activated by the antimalarial drug, chloroquine and may mediate chloroquine-induced itch, in an histamine-independent manner.
Synonyms	GPCR; MGRG2; MRGX1; SNSR4
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Druggable Genome, GPCR, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.