BBS2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-BBS2 antibody: synthetic peptide directed towards the middle region of human BBS2. Synthetic peptide located within the following region: RGYLPGTAEMRGNLMDTSAEQDLIRELSQKKQNLLLELRNYEENAKAELA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	80 kDa
Gene Name	Bardet-Biedl syndrome 2
Database Link	NP_114091 Entrez Gene 583 Human UniProt ID Q9BXC9
Background	This gene is a member of the Bardet-Biedl syndrome (BBS) gene family. Bardet-Biedl syndrome is an autosomal recessive disorder characterized by severe pigmentary retinopathy, obesity, polydactyly, renal malformation and mental retardation. The proteins encoded by BBS gene family members are structurally diverse and the similar phenotypes exhibited by mutations in BBS gene family members is likely due to their shared roles in cilia formation and function. Many BBS proteins localize to the basal bodies, ciliary axonemes, and pericentriolar regions of cells. BBS proteins may also be involved in intracellular trafficking via microtubule-related transport. The protein encoded by this gene forms a multiprotein BBSome complex with six other BBS proteins.
Synonyms	BBS
Note	Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Pig: 93%; Guinea pig: 93%; Mouse: 86%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.