RASSF6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RASSF6 antibody: synthetic peptide directed towards the middle region of human RASSF6. Synthetic peptide located within the following region: FDDLYRISELDRTQIPMSEKRNSQEDYLSYHSNTLKPHAKDEPDSPVLYR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	41 kDa
Gene Name	Ras association domain family member 6
Database Link	NP_958834 Entrez Gene 166824 Human UniProt ID Q6ZTQ3
Background	RASSF6 is a member of the RAS association (RA) domain family of RAS effectors/tumor suppressors that mediate some of the growth inhibitory properties of RAS (see HRAS; MIM 190020) oncogenes (Eckfeld et al., 2004 [PubMed 15574778]).
Synonyms	DKFZp686K23225
Note	Immunogen Sequence Homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.