Metabotropic Glutamate Receptor 3 (GRM3) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GRM3 antibody is: synthetic peptide directed towards the C-terminal region of HUMAN GRM3. Synthetic peptide located within the following region: RDFWEQKFQCSLQNKRNHRRVCDKHLAIDSSNYEQESKIMFVVNAVYAMA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	59 kDa
Gene Name	glutamate metabotropic receptor 3
Database Link	NP_000831 Entrez Gene 2913 Human UniProt ID Q14832
Background	The function of this protein remains unknown.
Synonyms	GLUR3; GPRC1C; mGlu3; MGLUR3
Note	Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 93%; Bovine: 92%; Rabbit: 85%
Reference Data
Protein Families	Druggable Genome, GPCR, Transmembrane
Protein Pathways	Neuroactive ligand-receptor interaction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.