ZYG11BL (ZER1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZER1 antibody is: synthetic peptide directed towards the C-terminal region of Human ZER1. Synthetic peptide located within the following region: YCPLLIKEGGMPLLRDIIKMATARQETKEMARKVIEHCSNFKEENMDTSR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	88 kDa
Gene Name	zyg-11 related cell cycle regulator
Database Link	NP_006327 Entrez Gene 10444 Human UniProt ID Q7Z7L7
Background	ZER1 probably acts as target recruitment subunit in the E3 ubiquitin ligase complex ZER1-CUL2-Elongin BC.
Synonyms	C9orf60; ZYG; ZYG11BL
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Mouse: 93%; Rabbit: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.