FOXN4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FOXN4 antibody: synthetic peptide directed towards the middle region of human FOXN4. Synthetic peptide located within the following region: QGNLWEEMKDEGFSLDTLGAFADSPLGCDLGASGLTPASGGSDQSFPDLQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	36 kDa
Gene Name	forkhead box N4
Database Link	NP_998761 Entrez Gene 121643 Human UniProt ID Q96NZ1
Background	Members of the winged-helix/forkhead family of transcription factors, such as FOXN4, are characterized by a 110-amino acid DNA-binding domain that can fold into a variant of the helix-turn-helix motif consisting of 3 alpha helices flanked by 2 large loops or wings. These transcription factors are involved in a variety of biologic processes as key regulators in development and metabolism (Li et al., 2004 [PubMed 15363391]). [supplied by OMIM, Mar 2008]. ##Evidence-Data-START## Transcript exon combination :: BC146825.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025094 [ECO:0000348] ##Evidence-Data-END##
Synonyms	FLJ35967
Note	Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 93%; Bovine: 93%; Mouse: 79%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.