zinc finger protein 138 (ZNF138) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF138 antibody: synthetic peptide directed towards the middle region of human ZNF138. Synthetic peptide located within the following region: TFNWSTNLSKPKKIHTGEKPYKCEVCGKAFHQSSILTKHKIIRTGEKPYK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	31 kDa
Gene Name	zinc finger protein 138
Database Link	NP_006515 Entrez Gene 7697 Human UniProt ID P52744
Background	May be involved in transcriptional regulation as a repressor.
Synonyms	pHZ-32
Note	Immunogen Sequence Homology: Human: 100%; Mouse: 92%; Zebrafish: 92%; Rat: 91%; Dog: 85%; Horse: 85%; Bovine: 85%; Pig: 77%; Guinea pig: 77%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.