FAM82A2 (RMDN3) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FAM82C antibody: synthetic peptide directed towards the middle region of human FAM82C. Synthetic peptide located within the following region: LSATVEDALQSFLKAEELQPGFSKAGRVYISKCYRELGKNSEARWWMKLA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	52 kDa
Gene Name	regulator of microtubule dynamics 3
Database Link	NP_060615 Entrez Gene 55177 Human UniProt ID Q96TC7
Background	FAM82C may participate in differentiation and apoptosis of keratinocytes. Overexpression of FAM82C protein induces apoptosis.
Synonyms	FAM82A2; FAM82C; ptpip51; RMD-3; RMD3
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.