Pus1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Pus1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GGWVWEETEHPAKRVKGGEDEEPPRKLPKRKIVLLMAYSGKGYHGMQRNL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	44 kDa
Gene Name	pseudouridine synthase 1
Database Link	NP_001020733 Entrez Gene 56361 Mouse UniProt ID Q9WU56
Background	Pus1 converts specific uridines to PSI in a number of tRNA substrates. Pus1 acts on positions 27/28 in the anticodon stem and also positions 34 and 36 in the anticodon of an intron containing tRNA. Pus1 is involved in regulation of nuclear receptor activity possibly through pseudouridylation of SRA1 RNA.
Synonyms	DOBI; MGC11268
Note	Immunogen Sequence Homology: Rat: 100%; Mouse: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.