Cited4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CITED4 antibody: synthetic peptide directed towards the N terminal of mouse CITED4. Synthetic peptide located within the following region: PYAGPGMDSGLRPRGAPLGPPPPPGTLAYGSFGSPVSFQPFPVSQSPGAG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	20 kDa
Gene Name	Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 4
Database Link	NP_062509 Entrez Gene 56222 Mouse UniProt ID Q9WUL8
Background	Cited4 is a member of The CITED family proteins that bind to CBP/p300 transcriptional integrators through their conserved C-terminal acidic domain and function as coactivators. It also interacts with isoforms of the TFAP2 transcription factor, coactivating TFAP2-dependent transcription.
Synonyms	MRG-2; MRG2
Note	Immunogen Sequence Homology: Rat: 100%; Mouse: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.