Cited4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Cited4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PPPPGTLAYGSFGSPVSFQPFPVSQSPGAGSTHLQSAATPSPGRIPAPPA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	18 kDa
Gene Name	Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 4
Database Link	NP_062509 Entrez Gene 56222 Mouse UniProt ID Q9WUL8
Background	Cited4 acts as transcriptional coactivator for TFAP2/AP-2.Cited4 may function as an inhibitor of transactivation by HIF1A by disrupting HIF1A interaction with CREBBP.Cited4 may be involved in regulation of gene expression during development and differentiation of blood cells, endothelial cells and mammary epithelial cells.
Synonyms	MRG-2; MRG2
Note	Immunogen Sequence Homology: Mouse: 100%; Rat: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.