Atf7ip Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Atf7ip antibody is: synthetic peptide directed towards the middle region of Mouse Atf7ip. Synthetic peptide located within the following region: MSTPEGEKSEKDGKAEEEERVPAEEQPPVRNEFSRRKRSKSEDMDSVESK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	138 kDa
Gene Name	activating transcription factor 7 interacting protein
Database Link	NP_062299 Entrez Gene 54343 Mouse UniProt ID Q7TT18
Background	Recruiter that couples transcriptional factors to general transcription apparatus and thereby modulates transcription regulation and chromatin formation. Atf7ip can both act as an activator or a repressor depending on the context. It mediates MBD1-dependent transcriptional repression, probably by recruiting complexes containing SETDB1. Atf7ip is required to stimulate histone methyltransferase activity of SETDB1 and facilitate the conversion of dimethylated to trimethylated H3 'Lys-9' (H3K9me3). The complex formed with MBD1 and SETDB1 represses transcription and couples DNA methylation and histone H3 'Lys-9' trimethylation (H3K9me3). Atf7ip may have ATPase activity.
Synonyms	ATF-IP; FLJ10139; FLJ10688; hAM; MCAF; MCAF1; p621
Note	Immunogen Sequence Homology: Mouse: 100%; Pig: 92%; Rat: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.