Mybbp1a Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MYBBP1A antibody: synthetic peptide directed towards the C terminal of mouse MYBBP1A. Synthetic peptide located within the following region: DAVTEGAMPAATGKDQPPSTGKKKRKRVKASTPSQVNGITGAKSPAPSNP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	148 kDa
Gene Name	MYB binding protein (P160) 1a
Database Link	NP_058056 Entrez Gene 18432 Mouse UniProt ID Q7TPV4
Background	Mybbp1a may activate or repress transcription via interactions with sequence specific DNA-binding proteins. Repression may be mediated at least in part by histone deacetylase activity.
Synonyms	FLJ37886; P160; PAP2
Note	Immunogen Sequence Homology: Mouse: 100%; Rat: 92%; Pig: 83%; Guinea pig: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.