Ecsit Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Ecsit antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EPWLVPRPPEPQRKPIKVPAMHEDSFKPSGNRERDKASFLNAVRSFGAHN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	50 kDa
Gene Name	ECSIT signalling integrator
Database Link	NP_036159 Entrez Gene 26940 Mouse UniProt ID Q9QZH6
Background	Ecsit is required for efficient assembly of mitochondrial NADH:ubiquinone oxidoreductase. Ecsit is an adapter protein of the Toll-like and IL-1 receptor signaling pathway that is involved in the activation of NF-kappa-B via MAP3K1.Ecsit promotes proteolytic activation of MAP3K1. Ecsit is involved in the BMP signaling pathway. Ecsit is required for normal embryonic development.
Synonyms	SITPEC
Note	Immunogen Sequence Homology: Mouse: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.