SOX7 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SOX7 antibody: synthetic peptide directed towards the N terminal of mouse SOX7. Synthetic peptide located within the following region: LGAYPWTEGLECPALEAELSDGLSPPAVPRPSGDKSSESRIRRPMNAFMV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	42 kDa
Gene Name	SRY-box 7
Database Link	NP_113627 Entrez Gene 20680 Mouse UniProt ID Q9BT81
Background	SOX7 belongs to the SOX family of transcription factors bind PS4A and differentially modulate transcription. It is a potent activator of Fgf-3 transcription.
Synonyms	MGC10895
Note	Immunogen Sequence Homology: Mouse: 100%; Rat: 93%; Human: 86%; Pig: 79%; Bovine: 79%
Reference Data
Protein Families	ES Cell Differentiation/IPS, Induced pluripotent stem cells, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.