LHX8 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Lhx8 antibody: synthetic peptide directed towards the N terminal of mouse Lhx8. Synthetic peptide located within the following region: AGEEGLVNPEGAGDEDSCSSSAPLSPSSSPQSMASGSVCPPGKCVCSSCG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	41 kDa
Gene Name	LIM homeobox 8
Database Link	NP_001001933 Entrez Gene 16875 Mouse UniProt ID Q68G74
Background	Transcription factor involved in differentiation of certain neurons and mesenchymal cells.
Synonyms	LHX7
Note	Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Human: 93%; Rabbit: 93%; Dog: 91%; Pig: 91%; Guinea pig: 91%; Bovine: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.