RALA Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RALA antibody: synthetic peptide directed towards the middle region of human RALA. Synthetic peptide located within the following region: GQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	23 kDa
Gene Name	RALA Ras like proto-oncogene A
Database Link	NP_005393 Entrez Gene 5898 Human UniProt ID P11233
Background	The product ofThis gene belongs toThe small GTPase superfamily, Ras family of proteins. GTP-binding proteins mediateThe transmembrane signaling initiated byThe occupancy of certain cell surface receptors.This gene encodes a low molecular mass ras-like GTP-binding protein that shares about 50% similarity with other ras proteins. [provided by RefSeq, Jul 2008]
Synonyms	RAL
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Goat: 86%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Pancreatic cancer, Pathways in cancer

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.