PDE1C Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PDE1C antibody: synthetic peptide directed towards the middle region of human PDE1C. Synthetic peptide located within the following region: IDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	72 kDa
Gene Name	phosphodiesterase 1C
Database Link	NP_005011 Entrez Gene 5137 Human UniProt ID Q14123
Background	Cyclic nucleotide phosphodiesterases (PDEs) catalyze hydrolysis ofThe cyclic nucleotides cAMP and cGMP toThe corresponding nucleoside 5-prime-monophosphates. Mammalian PDEs have been classified into several families based onTheir biochemical properties. Members ofThe PDE1 family, such as PDE1C, are calmodulin (see MIM 114180)-dependent PDEs (CaM-PDEs) that are stimulated by a calcium-calmodulin complex (Repaske et al., 1992 [PubMed 1326532]). [supplied by OMIM, Oct 2009]. Transcript Variant:This variant (1) differs inThe 5' and 3' UTR and has multiple coding region differences, compared to variant 3.These differences result in an isoform (1) with distinct N- and C-termini, compared to isoform 3. Variants 1 and 4 encodeThe same protein. Isoform 1 is also known as HCam-3B. Sequence Note:This RefSeq record was created from transcript and genomic sequence data to makeThe sequence consistent withThe reference genome assembly.The genomic coordinates used forThe transcript record were based on transcript alignments. Publication Note:This RefSeq record includes a subset ofThe publications that are available forThis gene. Please seeThe Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC022479.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete onThe 3' end.
Synonyms	cam-PDE 1C; hCam-3; Hcam3
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Rabbit: 93%; Horse: 92%; Guinea pig: 92%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Calcium signaling pathway, Olfactory transduction, Progesterone-mediated oocyte maturation, Purine metabolism

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.