MYO1E Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MYO1E antibody: synthetic peptide directed towards the middle region of human MYO1E. Synthetic peptide located within the following region: PKPQPKPKPQVPQCKALYAYDAQDTDELSFNANDIIDIIKEDPSGWWTGR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	127 kDa
Gene Name	myosin IE
Database Link	NP_004989 Entrez Gene 4643 Human UniProt ID Q12965
Background	This gene encodes a member ofThe nonmuscle class I myosins which are a subgroup ofThe unconventional myosin protein family.The unconventional myosin proteins function as actin-based molecular motors. Class I myosins are characterized by a head (motor) domain, a regulatory domain and a either a short or long tail domain. AmongThe class I myosins,This protein is distinguished by a long tail domain that is involved in crosslinking actin filaments.This protein localizes toThe cytoplasm and may be involved in intracellular movement and membrane trafficking. Mutations inThis gene areThe cause of focal segmental glomerulosclerosis-6.This gene has been referred to as myosin IC inThe literature but is distinct fromThe myosin IC gene located on chromosome 17. [provided by RefSeq, Jan 2012]
Synonyms	FSGS6; HuncM-IC; MYO1C
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.