SCO1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SCO1 antibody: synthetic peptide directed towards the middle region of human SCO1. Synthetic peptide located within the following region: ALLAGMKHVKKEKAEKLEKERQRHIGKPLLGGPFSLTTHTGERKTDKDYL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	SCO1 cytochrome c oxidase assembly protein
Database Link	NP_004580 Entrez Gene 6341 Human UniProt ID O75880
Background	Mammalian cytochrome c oxidase (COX) catalyzesThe transfer of reducing equivalents from cytochrome c to molecular oxygen and pumps protons acrossThe inner mitochondrial membrane. In yeast, 2 related COX assembly genes, SCO1 and SCO2 (synthesis of cytochrome c oxidase), enable subunits 1 and 2 to be incorporated intoThe holoprotein.This gene isThe human homolog toThe yeast SCO1 gene. [provided by RefSeq, Jul 2008]
Synonyms	SCOD1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 93%; Guinea pig: 93%; Yeast: 91%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.