RASGRF1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RASGRF1 antibody: synthetic peptide directed towards the N terminal of human RASGRF1. Synthetic peptide located within the following region: RELDNNRSALSAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	54 kDa
Gene Name	Ras protein specific guanine nucleotide releasing factor 1
Database Link	NP_722522 Entrez Gene 5923 Human UniProt ID Q13972
Background	The protein encoded byThis gene is a guanine nucleotide exchange factor (GEF) similar toThe Saccharomyces cerevisiae CDC25 gene product. Functional analysis has demonstrated thatThis protein stimulatesThe dissociation of GDP from RAS protein.The studies ofThe similar gene in mouse suggested thatThe Ras-GEF activity ofThis protein in brain can be activated by Ca2+ influx, muscarinic receptors, and G protein beta-gamma subunit. Mouse studies also indicated thatThe Ras-GEF signaling pathway mediated byThis protein may be important for long-term memory. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Mar 2009]
Synonyms	CDC25; CDC25L; GNRP; GRF1; GRF55; H-GRF55; PP13187; ras-GRF1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Horse: 93%; Rabbit: 93%; Zebrafish: 93%; Mouse: 85%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Focal adhesion, MAPK signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.