PTK9 (TWF1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TWF1 antibody: synthetic peptide directed towards the N terminal of human TWF1. Synthetic peptide located within the following region: MSHQTGIQASEDVKEIFARARNGKYRLLKISIENEQLVIGSYSQPSDSWD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	44 kDa
Gene Name	twinfilin actin binding protein 1
Database Link	NP_002813 Entrez Gene 5756 Human UniProt ID Q12792
Background	This gene encodes twinfilin, an actin monomer-binding protein conserved from yeast to mammals. Studies ofThe mouse counterpart suggest thatThis protein may be an actin monomer-binding protein, and its localization to cortical G-actin-rich structures may be regulated byThe small GTPase RAC1. [provided by RefSeq, Jul 2008]
Synonyms	A6; PTK9
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Zebrafish: 79%
Reference Data
Protein Families	Druggable Genome, Protein Kinase

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.