Trypsin (PRSS3) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PRSS3 antibody: synthetic peptide directed towards the N terminal of human PRSS3. Synthetic peptide located within the following region: VAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAH
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	33 kDa
Gene Name	protease, serine 3
Database Link	NP_031369 Entrez Gene 5646 Human UniProt ID P35030
Background	This gene encodes a trypsinogen, which is a member ofThe trypsin family of serine proteases.This enzyme is expressed inThe brain and pancreas and is resistant to common trypsin inhibitors. It is active on peptide linkages involvingThe carboxyl group of lysine or arginine.This gene is localized toThe locus of T cell receptor beta variable orphans on chromosome 9. Four transcript variants encoding different isoforms have been described forThis gene. [provided by RefSeq, Oct 2010]
Synonyms	MTG; PRSS4; T9; TRY3; TRY4
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Dog: 92%; Horse: 92%; Mouse: 92%; Rabbit: 92%; Bovine: 91%
Reference Data
Protein Families	Druggable Genome, Protease, Secreted Protein
Protein Pathways	Neuroactive ligand-receptor interaction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.