ZIK1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZIK1 antibody: synthetic peptide directed towards the N terminal of human ZIK1. Synthetic peptide located within the following region: LYLEVMLENFALVASLGCGHGTEDEETPSDQNVSVGVSQSKAGSSTQKTQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	55 kDa
Gene Name	zinc finger protein interacting with K protein 1
Database Link	NP_001010879 Entrez Gene 284307 Human UniProt ID Q3SY52
Background	ZIK1 may be a transcriptional repressor.
Synonyms	ZNF762
Note	Immunogen Sequence Homology: Human: 100%; Pig: 83%; Bovine: 83%; Rat: 77%; Horse: 75%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.