SPOP Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SPOP antibody: synthetic peptide directed towards the C terminal of human SPOP. Synthetic peptide located within the following region: YHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	42 kDa
Gene Name	speckle type BTB/POZ protein
Database Link	NP_001007227 Entrez Gene 8405 Human UniProt ID O43791
Background	SPOP may modulateThe transcriptional repression activities of death-associated protein 6 (DAXX), which interacts with histone deacetylase, core histones, and other histone-associated proteins. In mouse,The protein binds toThe putative leucine zipper domain of macroH2A1.2, a variant H2A histone that is enriched on inactivated X chromosomes.The BTB/POZ domain ofThis protein has been shown in other proteins to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes.This gene encodes a protein that may modulateThe transcriptional repression activities of death-associated protein 6 (DAXX), which interacts with histone deacetylase, core histones, and other histone-associated proteins. In mouse,The encoded protein binds toThe putative leucine zipper domain of macroH2A1.2, a variant H2A histone that is enriched on inactivated X chromosomes.The BTB/POZ domain ofThis protein has been shown in other proteins to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes. Alternative splicing ofThis gene results in multiple transcript variants encodingThe same protein.
Synonyms	BTBD32; TEF2
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.