LRRC15 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-LRRC15 antibody: synthetic peptide directed towards the N terminal of human LRRC15. Synthetic peptide located within the following region: LNISALIALRIEKNELSRITPGAFRNLGSLRYLSLANNKLQVLPIGLFQG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	64 kDa
Gene Name	leucine rich repeat containing 15
Database Link	NP_570843 Entrez Gene 131578 Human UniProt ID Q8TF66
Background	LRRC15 may contribute to regulation of cell-matrix adhesion interactions with respect to astrocyte recruitment around senile plaques in Alzheimer's disease brain. LRRC15 is induced by EWS-WT1(+KTS) inThe tumor DSRCT and may play a role in cellular invasion.
Synonyms	LIB
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.