GIMAP1 Rabbit Polyclonal Antibody

CAT#: TA342102

Rabbit Polyclonal Anti-GIMAP1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of GTPase, IMAP family member 1 (GIMAP1)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human GTPase, IMAP family member 1 (GIMAP1), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human GTPase, IMAP family member 1 (GIMAP1), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-GIMAP1 antibody: synthetic peptide directed towards the N terminal of human GIMAP1. Synthetic peptide located within the following region: MGGRKMATDEENVYGLEENAQSRQESTRRLILVGRTGAGKSATGNSILGQ
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 34 kDa
Gene Name GTPase, IMAP family member 1
Background GIMAP1 belonging toThe GTP-binding superfamily and toThe immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins.This gene encodes a protein belonging toThe GTP-binding superfamily and toThe immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans,The IAN subfamily genes are located in a cluster at 7q36.1.
Synonyms HIMAP1; IAN2; IMAP1; IMAP38
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...