GIMAP1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GIMAP1 antibody: synthetic peptide directed towards the N terminal of human GIMAP1. Synthetic peptide located within the following region: MGGRKMATDEENVYGLEENAQSRQESTRRLILVGRTGAGKSATGNSILGQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	GTPase, IMAP family member 1
Database Link	NP_570115 Entrez Gene 170575 Human UniProt ID Q8WWP7
Background	GIMAP1 belonging toThe GTP-binding superfamily and toThe immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins.This gene encodes a protein belonging toThe GTP-binding superfamily and toThe immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans,The IAN subfamily genes are located in a cluster at 7q36.1.
Synonyms	HIMAP1; IAN2; IMAP1; IMAP38
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.