ASB5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ASB5 antibody: synthetic peptide directed towards the C terminal of human ASB5. Synthetic peptide located within the following region: LLLEFGADINAKNTELLRPIDVATSSSMVERILLQHEATPSSLYQLCRLC
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	36 kDa
Gene Name	ankyrin repeat and SOCS box containing 5
Database Link	NP_543150 Entrez Gene 140458 Human UniProt ID Q8WWX0
Background	ASB5 is a member ofThe¡¡ankyrin repeat and SOCS box-containing (ASB) family of proteins.¡¡They contain ankyrin repeat sequence and SOCS box domain.The SOCS¡¡box serves to couple suppressor of cytokine signalling (SOCS)¡¡proteins andTheir binding partners withThe elongin B and C¡¡complex, possibly targetingThem for degradation.The protein encoded byThis gene is a member ofThe ankyrin repeat and SOCS box-containing (ASB) family of proteins.They contain ankyrin repeat sequence and SOCS box domain.The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins andTheir binding partners withThe elongin B and C complex, possibly targetingThem for degradation. Multiple alternatively spliced transcript variants have been described forThis gene butTheir full length sequences are not known.
Synonyms	ASB-5
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Dog: 86%; Guinea pig: 86%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.