B3gat2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-B3gat2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SDFLKQITTVEELEPKASNCTKVLVWHTRTEKVNLANEPKYHLDTVNIEV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	beta-1,3-glucuronyltransferase 2 (glucuronosyltransferase S)
Database Link	NP_742122 Entrez Gene 280645 Mouse UniProt ID P59270
Background	B3gat2 is involved inThe biosynthesis of L2/HNK-1 carbohydrate epitope on both glycolipids and glycoproteins.
Synonyms	GlcAT-D; GlcAT-S; GLCATS; Glucuronosyltransferase-S; KIAA1963; MGC138535; UDP-glucuronosyltransferase-S
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Rabbit: 93%; Pig: 92%; Rat: 92%; Guinea pig: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.