MT ND5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ND5 antibody: synthetic peptide directed towards the N terminal of human ND5. Synthetic peptide located within the following region: SIVASTFIISLFPTTMFMCLDQEVIISNWHWATTQTTQLSLSFKLDYFSM
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	66 kDa
Database Link	NP_776061 Entrez Gene 4540 Human
Background	ND5 isThe core subunit ofThe mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong toThe minimal assembly required for catalysis. Complex I functions inThe transfer of electrons from NADH toThe respiratory chain.The immediate electron acceptor forThe enzyme is believed to be ubiquinone.
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Metabolic pathways, Oxidative phosphorylation, Parkinson's disease

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.