ANKH Rabbit Polyclonal Antibody
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ANKH antibody: synthetic peptide directed towards the N terminal of human ANKH. Synthetic peptide located within the following region: SDLGYYIINKLHHVDESVGSKTRRAFLYLAAFPFMDAMAWTHAGILLKHK |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 54 kDa |
Gene Name | ANKH inorganic pyrophosphate transport regulator |
Database Link | |
Background | ANKH regulates intra- and extracellular levels of inorganic pyrophosphate (PPi), probably functioning as PPi transporter.This gene encodes a multipass transmembrane protein that is expressed in joints and other tissues and controls pyrophosphate levels in cultured cells. Progressive ankylosis-mediated control of pyrophosphate levels has been suggested as a possible mechanism regulating tissue calcification and susceptibility to arthritis in higher animals. Mutations inThis gene have been associated with autosomal dominant craniometaphyseal dysplasia. Publication Note:This RefSeq record includes a subset ofThe publications that are available forThis gene. Please seeThe Entrez Gene record to access additional publications. |
Synonyms | ANK; CCAL2; CMDJ; CPPDD; HANK; MANK |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Bovine: 93%; Zebrafish: 93% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |