CNTNAP3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CNTNAP3 antibody: synthetic peptide directed towards the middle region of human CNTNAP3. Synthetic peptide located within the following region: GSGPLGPFLVYCNMTADAAWTVVQHGGPDAVTLRGAPSGHPRSAVSFAYA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	141 kDa
Gene Name	contactin associated protein-like 3
Database Link	NP_387504 Entrez Gene 79937 Human UniProt ID Q9BZ76
Background	The specific function ofThis protein remains unknown.The protein encoded byThis gene belongs toThe NCP family of cell-recognition molecules.This family represents a distinct subgroup ofThe neurexins. NCP proteins mediate neuron-glial interactions in vertebrates and glial-glial contact in invertebrates.The protein encoded byThis gene may play a role in cell recognition withinThe nervous system. Alternatively spliced transcript variants encoding different isoforms have been described butTheir biological nature has not been determined.
Synonyms	CASPR3; CNTNAP3A
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Secreted Protein, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.