ADA2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CECR1 antibody: synthetic peptide directed towards the N terminal of human CECR1. Synthetic peptide located within the following region: MQFRFAHPTPRPSEKCSKWILLEDYRKRVQNVTEFDDSLLRNFTLVTQHP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	56 kDa
Gene Name	cat eye syndrome chromosome region, candidate 1
Database Link	NP_059120 Entrez Gene 51816 Human UniProt ID Q9NZK5
Background	This gene encodes a member of a subfamily ofThe adenosine deaminase protein family.The encoded protein is one of two adenosine deaminases found in humans, which regulate levels ofThe signaling molecule, adenosine.The encoded protein is secreted from monocytes undergoing differentiation and may regulate cell proliferation and differentiation.This gene may be responsible for some ofThe phenotypic features associated with cat eye syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]
Synonyms	ADA2; ADGF; IDGFL
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Druggable Genome, Secreted Protein, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.