PCDH12 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PCDH12 antibody: synthetic peptide directed towards the middle region of human PCDH12. Synthetic peptide located within the following region: SSRPFLLTTIVARDADSGANGEPLYSIRSGNEAHLFILNPHTGQLFVNVT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	126 kDa
Gene Name	protocadherin 12
Database Link	NP_057664 Entrez Gene 51294 Human UniProt ID Q9NPG4
Background	This gene belongs toThe protocadherin gene family, a subfamily ofThe cadherin superfamily.The encoded protein consists of an extracellular domain containing 6 cadherin repeats, a transmembrane domain and a cytoplasmic tail that differs from those ofThe classical cadherins.The gene localizes toThe region on chromosome 5 whereThe protocadherin gene clusters reside.The exon organization ofThis transcript is similar to that ofThe gene cluster transcripts, notablyThe first large exon, but no significant sequence homology exists.The function ofThis cellular adhesion protein is undetermined but mouse protocadherin 12 does not bind catenins and appears to have no affect on cell migration or growth. [provided by RefSeq, Jul 2008]
Synonyms	VE-cadherin-2; VECAD2
Note	Immunogen Sequence Homology: Human: 100%; Dog: 92%; Pig: 92%; Rat: 86%; Horse: 86%; Bovine: 85%; Guinea pig: 85%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.