ACSL5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ACSL5 antibody: synthetic peptide directed towards the C terminal of human ACSL5. Synthetic peptide located within the following region: ACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	76 kDa
Gene Name	acyl-CoA synthetase long-chain family member 5
Database Link	NP_976313 Entrez Gene 51703 Human UniProt ID Q9ULC5
Background	The protein encoded byThis gene is an isozyme ofThe long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes ofThis family convert free long-chain fatty acids into fatty acyl-CoA esters, andThereby play a key role in lipid biosynthesis and fatty acid degradation.This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas.This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found forThis gene. [provided by RefSeq, Jul 2008]
Synonyms	ACS2; ACS5; FACL5
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Zebrafish: 93%; Bovine: 92%; Pig: 86%; Horse: 86%; Rabbit: 86%; Guinea pig: 86%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Adipocytokine signaling pathway, Fatty acid metabolism, Metabolic pathways, PPAR signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.