NSDHL Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NSDHL antibody: synthetic peptide directed towards the middle region of human NSDHL. Synthetic peptide located within the following region: RAVLGANDPEKNFLTTAIRPHGIFGPRDPQLVPILIEAARNGKMKFVIGN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	42 kDa
Gene Name	NAD(P) dependent steroid dehydrogenase-like
Database Link	NP_057006 Entrez Gene 50814 Human UniProt ID Q15738
Background	The protein encoded byThis gene is localized inThe endoplasmic reticulum and is involved in cholesterol biosynthesis. Mutations inThis gene are associated with CHILD syndrome, which is a X-linked dominant disorder of lipid metabolism with disturbed cholesterol biosynthesis, and typically lethal in males. Alternatively spliced transcript variants with differing 5' UTR have been found forThis gene. [provided by RefSeq, Jul 2008]
Synonyms	H105E3; SDR31E1; XAP104
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 86%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Metabolic pathways, Steroid biosynthesis

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.