COQ2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-COQ2 antibody: synthetic peptide directed towards the middle region of human COQ2. Synthetic peptide located within the following region: FSGVMWTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWLSGFSVAML
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	42 kDa
Gene Name	coenzyme Q2, polyprenyltransferase
Database Link	NP_056512 Entrez Gene 27235 Human
Background	This gene encodes an enzyme that functions inThe final steps inThe biosynthesis of CoQ (ubiquinone), a redox carrier inThe mitochondrial respiratory chain and a lipid-soluble antioxidant.This enzyme, which is part ofThe coenzyme Q10 pathway, catalyzesThe prenylation of parahydroxybenzoate with an all-trans polyprenyl group. Mutations inThis gene cause coenzyme Q10 deficiency, a mitochondrial encephalomyopathy, and also COQ2 nephropathy, an inherited form of mitochondriopathy with primary renal involvement. [provided by RefSeq, Oct 2009]
Synonyms	CL640; COQ10D1; MSA1
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rabbit: 93%; Yeast: 91%; Pig: 86%; Rat: 86%; Mouse: 86%; Zebrafish: 86%; Goat: 79%; Horse: 79%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Ubiquinone and other terpenoid-quinone biosynthesis

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.