COQ2 Rabbit Polyclonal Antibody

CAT#: TA341982

Rabbit Polyclonal Anti-COQ2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 50 ug

Cited in 2 publications.

Product images

经常一起买 (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-COQ2 antibody: synthetic peptide directed towards the middle region of human COQ2. Synthetic peptide located within the following region: FSGVMWTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWLSGFSVAML
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 42 kDa
Gene Name coenzyme Q2, polyprenyltransferase
Background This gene encodes an enzyme that functions inThe final steps inThe biosynthesis of CoQ (ubiquinone), a redox carrier inThe mitochondrial respiratory chain and a lipid-soluble antioxidant.This enzyme, which is part ofThe coenzyme Q10 pathway, catalyzesThe prenylation of parahydroxybenzoate with an all-trans polyprenyl group. Mutations inThis gene cause coenzyme Q10 deficiency, a mitochondrial encephalomyopathy, and also COQ2 nephropathy, an inherited form of mitochondriopathy with primary renal involvement. [provided by RefSeq, Oct 2009]
Synonyms CL640; COQ10D1; MSA1
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rabbit: 93%; Yeast: 91%; Pig: 86%; Rat: 86%; Mouse: 86%; Zebrafish: 86%; Goat: 79%; Horse: 79%
Reference Data
Protein Families Transmembrane
Protein Pathways Ubiquinone and other terpenoid-quinone biosynthesis
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)

Customer Reviews 
Loading...