OLFML2B Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-OLFML2B antibody: synthetic peptide directed towards the N terminal of human OLFML2B. Synthetic peptide located within the following region: EEVSKNLTKENEQIKEDMEEIRTEMNKRGKENCSENILDSMPDIRSALQR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	84 kDa
Gene Name	olfactomedin like 2B
Database Link	NP_056256 Entrez Gene 25903 Human UniProt ID Q68BL8
Background	The exact function of OLFML2B remains unknown.
Synonyms	RP11-227F8.1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.