SV2B Rabbit Polyclonal Antibody
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-SV2B antibody is: synthetic peptide directed towards the C-terminal region of Human SV2B. Synthetic peptide located within the following region: TINFTMENQIHQHGKLVNDKFTRMYFKHVLFEDTFFDECYFEDVTSTDTY |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 77 kDa |
Gene Name | synaptic vesicle glycoprotein 2B |
Database Link | |
Background | Probably plays a role inThe control of regulated secretion in neural and endocrine cells. |
Synonyms | HsT19680 |
Note | Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%; Dog: 86% |
Reference Data | |
Protein Families | Secreted Protein, Transmembrane |
Protein Pathways | ECM-receptor interaction |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |